PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK23829.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family MYB_related
Protein Properties Length: 314aa    MW: 34234.8 Da    PI: 7.9071
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK23829.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.29.1e-14100144347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++l++ + ++ G+g+W+ I+r + k Rt+ q+ s+ qky
        PK23829.1 100 PWTEEEHKLFLLGLQKVGKGDWRGISRNFVKSRTPTQVASHAQKY 144
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.30193149IPR017930Myb domain
SuperFamilySSF466891.27E-1695149IPR009057Homeodomain-like
TIGRFAMsTIGR015574.4E-1796147IPR006447Myb domain, plants
SMARTSM007173.1E-1097147IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.6E-1199144IPR009057Homeodomain-like
PfamPF002498.2E-11100144IPR001005SANT/Myb domain
CDDcd001674.04E-9100145No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MSFPTSSNDS SSAAVPDDSG VGEFMLFGVR VVVDSMRKSV SLNNLSQYEQ PQEVAAAATV  60
AANNNNNAGK DDGGPGYASD NDVVHNSGGN RERERKRGVP WTEEEHKLFL LGLQKVGKGD  120
WRGISRNFVK SRTPTQVASH AQKYFLRRTN HNRRRRRSSL FDITTDTVTA IPMEEEQYHN  180
QDNACHSLSH PLPPLNPEPF NPSGRFSLHT TVSPSPIENL SLGQTHPEIN NSTNTTADPK  240
LVRPIALHSI PHGTTIADFN LNLKSAVDPS PLSLKLALPT TNPRETPSSS SAARYSAFQS  300
MSSFANGDSF ITVA
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00631PBM25215497Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010087735.11e-130Transcription factor
SwissprotQ2V9B04e-68MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLW9QL741e-130W9QL74_9R
STRINGGLYMA05G01640.14e-84(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42483154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19000.26e-59MYB_related family protein